PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KFK41242.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Arabideae; Arabis
Family MYB
Protein Properties Length: 287aa    MW: 33377 Da    PI: 5.2059
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KFK41242.1genomeMPIPBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding53.84.4e-172067148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg+WT eEd ll +++   G g+W+++a++ g++Rt+k+c++rw++yl
       KFK41242.1 20 RGPWTLEEDTLLTNYILHNGEGRWNLVAKCAGLKRTGKSCRLRWLNYL 67
                     89********************************************97 PP

2Myb_DNA-binding51.91.7e-1673116146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rg+ T++E++l+++++ ++G++ W++Ia++++ gRt++++k++w++
       KFK41242.1  73 RGNLTPQEQLLILELHSKWGNR-WSKIAQYLP-GRTDNEIKNYWRT 116
                      7999******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129415.4311567IPR017930Myb domain
SuperFamilySSF466892.32E-3018114IPR009057Homeodomain-like
SMARTSM007174.9E-141969IPR001005SANT/Myb domain
PfamPF002491.6E-152067IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.9E-222174IPR009057Homeodomain-like
CDDcd001673.63E-102267No hitNo description
PROSITE profilePS5129425.26468122IPR017930Myb domain
SMARTSM007171.4E-1472120IPR001005SANT/Myb domain
PfamPF002491.5E-1573116IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.607.7E-2375121IPR009057Homeodomain-like
CDDcd001672.11E-1177116No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009686Biological Processgibberellin biosynthetic process
GO:0009751Biological Processresponse to salicylic acid
GO:0016036Biological Processcellular response to phosphate starvation
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 287 aa     Download sequence    Send to blast
MDNSMKKKSF KESEDTELRR GPWTLEEDTL LTNYILHNGE GRWNLVAKCA GLKRTGKSCR  60
LRWLNYLKPD IRRGNLTPQE QLLILELHSK WGNRWSKIAQ YLPGRTDNEI KNYWRTRVQK  120
QARQLNIESN SDKFFDAVRS FWVPRLIEKM EQNSSSTTNY CCPQNINTNN NDSLLPPSQS  180
HDSKSIQTYT DFSGQNICLS NIDGSTSSST FMSDLTTVPH FMDHNNFTDG SLCFHEGYDQ  240
ELGGYIPGME DDYMGNQECH VADGYSVYED VTQDPMWNMD DIWQFRD
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A3e-24171224108B-MYB
1gv2_A2e-24171221105MYB PROTO-ONCOGENE PROTEIN
1h88_C9e-241712255159MYB PROTO-ONCOGENE PROTEIN
1h89_C9e-241712255159MYB PROTO-ONCOGENE PROTEIN
1h8a_C4e-241512222128MYB TRANSFORMING PROTEIN
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00216DAPTransfer from AT1G68320Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006391151.11e-171hypothetical protein EUTSA_v10018962mg
TrEMBLA0A087HGJ00.0A0A087HGJ0_ARAAL; Uncharacterized protein
STRINGBra033948.1-P1e-169(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM26322571
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G68320.11e-167myb domain protein 62